PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 347aa    MW: 39141.3 Da    PI: 6.4027
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d++ ++G g+W++ ++  g++R++k+c++rw +yl
   XP_009594598.1 14 KGPWTPEEDQKLIDYIDKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
   XP_009594598.1  67 RGKFSEEEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.402961IPR017930Myb domain
SuperFamilySSF466895.03E-3211108IPR009057Homeodomain-like
SMARTSM007171.2E-151363IPR001005SANT/Myb domain
PfamPF002496.4E-181461IPR001005SANT/Myb domain
CDDcd001671.16E-121661No hitNo description
PROSITE profilePS5129427.52962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2765117IPR009057Homeodomain-like
SMARTSM007175.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.4E-1667112IPR001005SANT/Myb domain
CDDcd001676.72E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLIDYID KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHRPRT DLFASLPNII ALANLLQHHP LEDHAVRLQT EAAQLAKLQY LQFLFQSSSA  180
SNNYPISSSN TQYNLGDFGA FNLSNSIKES TTPSLNLSHL ENQTLFSNEN SDSQLLQNQD  240
TSLHLPDTQQ VPFNFQTHLN NNINTSDING HNFNFDQGND STSSPLNNIN LPSPTSSSRL  300
PPLTEISISN NNQGDSSSTS TNAAEGITSS YNWPELFFEE HFMHEIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594598.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_016464328.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM1A7L80.0M1A7L8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000163940.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-110myb domain protein 93